Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYVE1 Peptide - C-terminal region

LYVE1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HAR, XLKD1, LYVE-1, CRSBP-1

UniProt

Q9Y5Y7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LYVE1 Rabbit Polyclonal Antibody (orb588297) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006682.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PFTNKNQQKEMIETKVVKEEKANDSNPNEESKKTDKNPEESKSPSKTTVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIGD1A (NM_001099669) Human Over-expression Lysate
LC420483 20 µg

HIGD1A (NM_001099669) Human Over-expression Lysate

Sign In for Pricing
View Details
USP9X Human Gene Knockout Kit (CRISPR)
KN217531RB 1 Kit

USP9X Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human MDP1 Protein (His Tag)
PKSH032728-01 10 µg

Recombinant Human MDP1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human MDP1 Protein (His Tag)
PKSH032728-02 50 µg

Recombinant Human MDP1 Protein (His Tag)

Sign In for Pricing
View Details
PMP2 (NM_002677) Human Over-expression Lysate
LC400948 20 µg

PMP2 (NM_002677) Human Over-expression Lysate

Sign In for Pricing
View Details
TEX29 (NM_152324) Human Recombinant Protein
TP306720L 1 mg

TEX29 (NM_152324) Human Recombinant Protein

Sign In for Pricing
View Details