Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBNL2 Peptide - N-terminal region

MBNL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MBLL, MBLL39, PRO2032

UniProt

Q5VZF2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MBNL2 Rabbit Polyclonal Antibody (orb588300) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001292999.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSRENCKY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDCP1, CT (CDCP1, TRASK, CUB domain-containing protein 1, Membrane glycoprotein gp140, Subtractive immunization M plus HEp3-associated 135kD protein, Transmembrane and associated with src kinases, CD318) (MaxLight 405) discontinued
033616-ML405 100 µL

CDCP1, CT (CDCP1, TRASK, CUB domain-containing protein 1, Membrane glycoprotein gp140, Subtractive immunization M plus HEp3-associated 135kD protein, Transmembrane and associated with src kinases, CD318) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Human DNAH3 siRNA
abx914317-01 15 nmol

Human DNAH3 siRNA

Sign In for Pricing
View Details
Human DNAH3 siRNA
abx914317-02 30 nmol

Human DNAH3 siRNA

Sign In for Pricing
View Details
Bacteria-Derived Clusterin nuclear form Recombinant Protein His Tag 50UG
IBCTCLSNUCFRHIS50UG 50 µg

Bacteria-Derived Clusterin nuclear form Recombinant Protein His Tag 50UG

Sign In for Pricing
View Details
GPR63, CT (GPR63, PSP24B, Probable G-protein coupled receptor 63, PSP24-2, PSP24-beta) (MaxLight 650)
MBS6303983-01 0.1 mL

GPR63, CT (GPR63, PSP24B, Probable G-protein coupled receptor 63, PSP24-2, PSP24-beta) (MaxLight 650)

Sign In for Pricing
View Details
GPR63, CT (GPR63, PSP24B, Probable G-protein coupled receptor 63, PSP24-2, PSP24-beta) (MaxLight 650)
MBS6303983-02 5x 0.1 mL

GPR63, CT (GPR63, PSP24B, Probable G-protein coupled receptor 63, PSP24-2, PSP24-beta) (MaxLight 650)

Sign In for Pricing
View Details