Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBNL2 Peptide - N-terminal region

MBNL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MBLL, MBLL39, PRO2032

UniProt

Q5VZF2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MBNL2 Rabbit Polyclonal Antibody (orb588300) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001292999.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSRENCKY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nudt15 (NM_001106049) Rat Tagged ORF Clone Lentiviral Particle
RR207505L4V 200 µL

Nudt15 (NM_001106049) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Retigabine-d4 Dihydrochloride
020572 2.5 mg

Retigabine-d4 Dihydrochloride

Sign In for Pricing
View Details
Recombinant EV71 VP0 Protein [GST]
VAng-Lsx0131-10g 10 µg

Recombinant EV71 VP0 Protein [GST]

Sign In for Pricing
View Details
CPLX4 Over-expression Lysate Product
GWB-14970C 0.1 mg

CPLX4 Over-expression Lysate Product

Sign In for Pricing
View Details
Adenovirus, Hexon
MBS633044-01 0.2 mg

Adenovirus, Hexon

Sign In for Pricing
View Details
Adenovirus, Hexon
MBS633044-02 5x 0.2 mg

Adenovirus, Hexon

Sign In for Pricing
View Details