Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTO1 Peptide - C-terminal region

MTO1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CGI-02, COXPD10

UniProt

Q9Y2Z2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTO1 Rabbit Polyclonal Antibody (orb588305) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001116698.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HFSRPQTIGAASRIPGVTPAAIINLLRFVKTTQRRQSAMNESSKTDQYLC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccdc27 Mouse Gene Knockout Kit (CRISPR)
KN502702 1 Kit

Ccdc27 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3193), Biotin conjugate, 0.1mg/mL
BNCB3193-100 1x 100 µL

Prohibitin (Mitochondrial Marker) (PHB/3193), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RHOH (NM_001278369) Human Tagged ORF Clone
RG236447 10 µg

RHOH (NM_001278369) Human Tagged ORF Clone

Sign In for Pricing
View Details
LY108 (SLAMF6) (NM_001184715) Human Recombinant Protein
TP329827 20 µg

LY108 (SLAMF6) (NM_001184715) Human Recombinant Protein

Sign In for Pricing
View Details
Wnt8b Mouse Gene Knockout Kit (CRISPR)
KN519461 1 Kit

Wnt8b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ankrd1 Mouse Gene Knockout Kit (CRISPR)
KN501262 1 Kit

Ankrd1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details