Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPTN Peptide - C-terminal region

NPTN Peptide - C-terminal region

Product Specifications

Product Name Alternative

GP55, GP65, SDR1, np55, np65, SDFR1

UniProt

Q9Y639

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NPTN Rabbit Polyclonal Antibody (orb588311) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001154835.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AEIIILVVIIVVYEKRKRPDEVPDDDEPAGPMKTNSTNNHKDKNLRQRNT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PICALM Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-62870R-BF488-TR 20 µL

PICALM Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Spata45 shRNA (UAS) - Lentiviral mouse Spata45 shRNA (UAS, iRFP) plasmid
GTR15263764 1 Vial

Lentiviral mouse Spata45 shRNA (UAS) - Lentiviral mouse Spata45 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
OPA1 (Optic Atrophy 1, Optic Atrophy 1 Gene Protein, Optic Atrophy Protein 1, Dynamin-like 120kD Protein)
299486 100 µL

OPA1 (Optic Atrophy 1, Optic Atrophy 1 Gene Protein, Optic Atrophy Protein 1, Dynamin-like 120kD Protein)

Sign In for Pricing
View Details
Hspb8 ELISA Kit (Rat) (OKCD01622)
OKCD01622 96 Well

Hspb8 ELISA Kit (Rat) (OKCD01622)

Sign In for Pricing
View Details
Human C1QB Recombinant Protein
PPT-10898 100 µg

Human C1QB Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human IFN-beta Protein
orb3002500-01 10 µg

Recombinant Human IFN-beta Protein

Sign In for Pricing
View Details