Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT9 Peptide - middle region

NUDT9 Peptide - middle region

Product Specifications

Product Name Alternative

NUDT10

UniProt

Q9BW91

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUDT9 Rabbit Polyclonal Antibody (orb588313) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001234940.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSRCRGIQAFRNSFSSSWFHLNTNVMSGSNGSKENSHNKARTSPYPGSKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PDCD1/PD-1/CD279 Antibody (Finotonlimab)
F1327-.1 100 µg

Anti-PDCD1/PD-1/CD279 Antibody (Finotonlimab)

Sign In for Pricing
View Details
C4orf19 CRISPR All-in-one AAV vector set (with saCas9)(Human)
14525151 3x 1.0 µg DNA

C4orf19 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
BTF3 sgRNA CRISPR Lentivector (Human) (Target 1)
K0199902 1.0 µg DNA

BTF3 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Anti-TFEC Antibody Picoband®
A07841-3-carrier-free 100 µg/Vial

Anti-TFEC Antibody Picoband®

Sign In for Pricing
View Details
Rabbit Polyclonal ZDHHC4 Antibody [mFluor Violet 500 SE]
NBP2-97818MFV500 0.1 mL

Rabbit Polyclonal ZDHHC4 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
HRNR CRISPRa sgRNA lentivector (set of three targets)(Mouse)
23904124 3x 1.0µg DNA

HRNR CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details