Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT9 Peptide - middle region

NUDT9 Peptide - middle region

Product Specifications

Product Name Alternative

NUDT10

UniProt

Q9BW91

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUDT9 Rabbit Polyclonal Antibody (orb588313) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001234940.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSRCRGIQAFRNSFSSSWFHLNTNVMSGSNGSKENSHNKARTSPYPGSKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RETNLB Antibody
orb1559401-01 50 µL

RETNLB Antibody

Sign In for Pricing
View Details
RETNLB Antibody
orb1559401-02 100 µL

RETNLB Antibody

Sign In for Pricing
View Details
RETNLB Antibody
orb1559401-03 200 µL

RETNLB Antibody

Sign In for Pricing
View Details
SGLT inhibitor-1
MBS3843683-01 1 mg

SGLT inhibitor-1

Sign In for Pricing
View Details
SGLT inhibitor-1
MBS3843683-02 5 mg

SGLT inhibitor-1

Sign In for Pricing
View Details
SGLT inhibitor-1
MBS3843683-03 10 mg

SGLT inhibitor-1

Sign In for Pricing
View Details