Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT9 Peptide - middle region

NUDT9 Peptide - middle region

Product Specifications

Product Name Alternative

NUDT10

UniProt

Q9BW91

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUDT9 Rabbit Polyclonal Antibody (orb588313) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001234940.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSRCRGIQAFRNSFSSSWFHLNTNVMSGSNGSKENSHNKARTSPYPGSKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant rat Plasma kallikrein
OPCA00147-1MG 1 mg

Recombinant rat Plasma kallikrein

Sign In for Pricing
View Details
Human EDA Protein, hFc Tag
E33P100661 10 µg

Human EDA Protein, hFc Tag

Sign In for Pricing
View Details
UBC Human siRNA Oligo Duplex (Locus ID 7316)
SR304992 1 Kit

UBC Human siRNA Oligo Duplex (Locus ID 7316)

Sign In for Pricing
View Details
CSTF1 Rabbit Polyclonal Antibody
MBS9465993-01 0.05 mL

CSTF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CSTF1 Rabbit Polyclonal Antibody
MBS9465993-02 0.1 mL

CSTF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CSTF1 Rabbit Polyclonal Antibody
MBS9465993-03 5x 0.1 mL

CSTF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details