Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PABPC4 Peptide - middle region

PABPC4 Peptide - middle region

Product Specifications

Product Name Alternative

APP1, APP-1, PABP4, iPABP

UniProt

Q13310

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PABPC4 Rabbit Polyclonal Antibody (orb588317) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129125.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQMRPNPRWQQGGRPQGFQGMPSAIRQSGPRPTLRHLAPTGSECPDRLAM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit for Transketolase (TKT)
TRV-0037967-01 24 Tests

ELISA Kit for Transketolase (TKT)

Sign In for Pricing
View Details
ELISA Kit for Transketolase (TKT)
TRV-0037967-02 48 Tests

ELISA Kit for Transketolase (TKT)

Sign In for Pricing
View Details
ELISA Kit for Transketolase (TKT)
TRV-0037967-03 96 Tests

ELISA Kit for Transketolase (TKT)

Sign In for Pricing
View Details
ELISA Kit for Transketolase (TKT)
TRV-0037967-04 5x 96 Tests

ELISA Kit for Transketolase (TKT)

Sign In for Pricing
View Details
ELISA Kit for Transketolase (TKT)
TRV-0037967-05 10x 96 Tests

ELISA Kit for Transketolase (TKT)

Sign In for Pricing
View Details
Polyclonal Antibody to Tumor Necrosis Factor Related Apoptosis Inducing Ligand (TRAIL)
TRV-0050567-01 20 µL

Polyclonal Antibody to Tumor Necrosis Factor Related Apoptosis Inducing Ligand (TRAIL)

Sign In for Pricing
View Details