Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PABPC4 Peptide - middle region

PABPC4 Peptide - middle region

Product Specifications

Product Name Alternative

APP1, APP-1, PABP4, iPABP

UniProt

Q13310

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PABPC4 Rabbit Polyclonal Antibody (orb588317) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129125.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQMRPNPRWQQGGRPQGFQGMPSAIRQSGPRPTLRHLAPTGSECPDRLAM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LOC653949 Protein Lysate 20ug
IHULOC653949PLLY20UG 20 µg

Human LOC653949 Protein Lysate 20ug

Sign In for Pricing
View Details
LentimiRa-Off-hsa-miR-626 Vector
mh31094 500 ng

LentimiRa-Off-hsa-miR-626 Vector

Sign In for Pricing
View Details
Superoxide Anion Microplate Assay Kit
MBS8305395-01 100 Assays

Superoxide Anion Microplate Assay Kit

Sign In for Pricing
View Details
Superoxide Anion Microplate Assay Kit
MBS8305395-02 5x 100 Assays

Superoxide Anion Microplate Assay Kit

Sign In for Pricing
View Details
Fmoc- (R) -3-Amino-3- (2- thienyl) -propionic acid
CSB-DT4041 1 g

Fmoc- (R) -3-Amino-3- (2- thienyl) -propionic acid

Sign In for Pricing
View Details
Anti-Mouse SOST Monoclonal Antibody, AbD09097
PTX19176-01 50 µg

Anti-Mouse SOST Monoclonal Antibody, AbD09097

Sign In for Pricing
View Details