Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARN Peptide - middle region

PARN Peptide - middle region

Product Specifications

Product Name Alternative

DAN, DKCB6, PFBMFT4

UniProt

O95453

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PARN Rabbit Polyclonal Antibody (orb588320) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001127949.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fucosidase Alpha L1, Tissue (FUCa1) Polyclonal Antibody
CAU27084-01 100 µL

Fucosidase Alpha L1, Tissue (FUCa1) Polyclonal Antibody

Sign In for Pricing
View Details
Fucosidase Alpha L1, Tissue (FUCa1) Polyclonal Antibody
CAU27084-02 200 µL

Fucosidase Alpha L1, Tissue (FUCa1) Polyclonal Antibody

Sign In for Pricing
View Details
Fucosidase Alpha L1, Tissue (FUCa1) Polyclonal Antibody
CAU27084-03 1 mL

Fucosidase Alpha L1, Tissue (FUCa1) Polyclonal Antibody

Sign In for Pricing
View Details
SDHA 3'UTR Luciferase Stable Cell Line
TU022790 1.0 mL

SDHA 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Phentolamine Mesylate
S2038-100mg 100 mg

Phentolamine Mesylate

Sign In for Pricing
View Details
CNIH3 Human qPCR Template Standard (NM_152495)
HK202075 1 Kit

CNIH3 Human qPCR Template Standard (NM_152495)

Sign In for Pricing
View Details