Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARN Peptide - middle region

PARN Peptide - middle region

Product Specifications

Product Name Alternative

DAN, DKCB6, PFBMFT4

UniProt

O95453

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PARN Rabbit Polyclonal Antibody (orb588320) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001127949.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey-anti-Rabbit IgG (H&L) 10nm gold
110.311 2.5 mL

Donkey-anti-Rabbit IgG (H&L) 10nm gold

Sign In for Pricing
View Details
Cleaning solution for cosmetic industry (fats and oils) (500 ml bottle)
HI70630L 500 mL

Cleaning solution for cosmetic industry (fats and oils) (500 ml bottle)

Sign In for Pricing
View Details
Rabbit anti-Ankyrin 1 Antibody, Affinity Purified
A303-048A 100 µg

Rabbit anti-Ankyrin 1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Hephaestin (HEPH) (NM_138737) Human Mass Spec Standard
PH315550 10 µg

Hephaestin (HEPH) (NM_138737) Human Mass Spec Standard

Sign In for Pricing
View Details
2-Vinylpyridine (stabilized with 0.1% 4-tert-butylcatechol)
TRC-V487495-10G 10 g

2-Vinylpyridine (stabilized with 0.1% 4-tert-butylcatechol)

Sign In for Pricing
View Details
Gliclazide Impurity 13
RM-G120313-01 10 mg

Gliclazide Impurity 13

Sign In for Pricing
View Details