PCGF2 Peptide - middle region
PCGF2 Peptide - middle region
Product Specifications
Product Name Alternative
MEL-18, RNF110, ZNF144
UniProt
P35227
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PCGF2 Rabbit Polyclonal Antibody (orb588321) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_009075.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EQEKGALSDDEIVSLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRC
More Discoveries
Explore Other Products
Browse additional items from our catalog
K2805906 1.0 µg DNA
SPICE1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
Sign In for Pricing
View Details 
SR402815 1 Kit
Eif1ad3 Mouse siRNA Oligo Duplex (Locus ID 100039042)
Sign In for Pricing
View Details