Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCGF2 Peptide - middle region

PCGF2 Peptide - middle region

Product Specifications

Product Name Alternative

MEL-18, RNF110, ZNF144

UniProt

P35227

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCGF2 Rabbit Polyclonal Antibody (orb588321) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009075.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EQEKGALSDDEIVSLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRC

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MGAT4A  (8C5)
YF-MA17714 100 ug

Anti-MGAT4A (8C5)

Sign In for Pricing
View Details
Bovine IL-4 Affinity Purified Polyclonal Ab
AF2469-SP 25 µg

Bovine IL-4 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
HNRNPA2B1 Recombinant Protein
OPCA03126-1MG 1 mg

HNRNPA2B1 Recombinant Protein

Sign In for Pricing
View Details
AMOTL2 Human shRNA Plasmid Kit (Locus ID 51421)
TL306726 1 Kit

AMOTL2 Human shRNA Plasmid Kit (Locus ID 51421)

Sign In for Pricing
View Details
Pipette Pasteur
5013150/4 1 Each

Pipette Pasteur

Sign In for Pricing
View Details
ACAD11 (NM_032169) Human Over-expression Lysate
LH12681V 100 µg

ACAD11 (NM_032169) Human Over-expression Lysate

Sign In for Pricing
View Details