PCYT2 Peptide - middle region
PCYT2 Peptide - middle region
Product Specifications
Product Name Alternative
ET
UniProt
Q99447
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PCYT2 Rabbit Polyclonal Antibody (orb588322) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001171846.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![TrkB Recombinant Rabbit Monoclonal Antibody [JE58-22]](https://cdn.genprice.uk/products/992/68dd1c8e061270361ea82366/imageurl/et7111-38.webp)
ET7111-38 100 µL
TrkB Recombinant Rabbit Monoclonal Antibody [JE58-22]
Sign In for Pricing
View Details 
![ZNF69 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C6]](https://cdn.genprice.uk/products/937/68dd1b80061270361ea1e4aa/imageurl/ta808649bm.webp)
TA808649BM 100 µL
ZNF69 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C6]
Sign In for Pricing
View Details 