Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCYT2 Peptide - middle region

PCYT2 Peptide - middle region

Product Specifications

Product Name Alternative

ET

UniProt

Q99447

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCYT2 Rabbit Polyclonal Antibody (orb588322) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001171846.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK 2606414
TRC-G797510-5MG 5 mg

GSK 2606414

Sign In for Pricing
View Details
Erio Green B (Technical Grade)
TRC-E600093-500MG 500 mg

Erio Green B (Technical Grade)

Sign In for Pricing
View Details
Recombinant NPHP1 Antibody
RN-14670-01 50 μL

Recombinant NPHP1 Antibody

Sign In for Pricing
View Details
Recombinant NPHP1 Antibody
RN-14670-02 100 µL

Recombinant NPHP1 Antibody

Sign In for Pricing
View Details
Recombinant NPHP1 Antibody
RN-14670-03 1 mL

Recombinant NPHP1 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Uterus
CS708847 5x 5 µm

Tissue FFPE Sections, Uterus

Sign In for Pricing
View Details