PDE11A Peptide - N-terminal region
PDE11A Peptide - N-terminal region
Product Specifications
Product Name Alternative
PPNAD2
UniProt
Q9HCR9
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PDE11A Rabbit Polyclonal Antibody (orb588325) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001070664.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: WAGGSRGDGNLQRRASQKELRKSFARSKAIHVNRTYDEQVTSRAQEPLSS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP20346PU-N 100 µg
IKK alpha (CHUK) (+IKKB) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
![FHL2 Mouse Monoclonal Antibody [Clone ID: 11-134]](https://cdn.genprice.uk/products/937/68dd189c061270361e8fc97f/imageurl/am20016af-n.webp)
AM20016AF-N 100 µg
FHL2 Mouse Monoclonal Antibody [Clone ID: 11-134]
Sign In for Pricing
View Details 
KN402035 1 Kit
Tryptophan rich protein (WRB) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details