PDE11A Peptide - N-terminal region
PDE11A Peptide - N-terminal region
Product Specifications
Product Name Alternative
PPNAD2
UniProt
Q9HCR9
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PDE11A Rabbit Polyclonal Antibody (orb588325) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001070664.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: WAGGSRGDGNLQRRASQKELRKSFARSKAIHVNRTYDEQVTSRAQEPLSS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942501-500 1x 500 µL
CD68 (Macrophage Marker) (C68/2501), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![p75 NGF Receptor (NGFR) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6D2]](https://cdn.genprice.uk/products/937/68dd1b87061270361ea21055/imageurl/ta812999bm.webp)
TA812999BM 100 µL
p75 NGF Receptor (NGFR) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6D2]
Sign In for Pricing
View Details 
