Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEPD Peptide - middle region

PEPD Peptide - middle region

Product Specifications

Product Name Alternative

PROLIDASE

UniProt

P12955

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PEPD Rabbit Polyclonal Antibody (orb588332) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000276.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC9B1 Pre-designed siRNA Set A
SI015220A 1 Each

Human SLC9B1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
AdmiRa-mmu-miR-451b Virus
mm1406 250 µL

AdmiRa-mmu-miR-451b Virus

Sign In for Pricing
View Details
Rel-2- (tert-Butoxycarbonyl) octahydrocyclopenta[c]pyrrole-3a-carboxylic acid
TYD-03202-01 10 mg

Rel-2- (tert-Butoxycarbonyl) octahydrocyclopenta[c]pyrrole-3a-carboxylic acid

Sign In for Pricing
View Details
Rel-2- (tert-Butoxycarbonyl) octahydrocyclopenta[c]pyrrole-3a-carboxylic acid
TYD-03202-02 50 mg

Rel-2- (tert-Butoxycarbonyl) octahydrocyclopenta[c]pyrrole-3a-carboxylic acid

Sign In for Pricing
View Details
D-Ribofuranose
AAA61383 5000 g

D-Ribofuranose

Sign In for Pricing
View Details
FGL1 Antibody
orb1554865-01 50 μL

FGL1 Antibody

Sign In for Pricing
View Details