PEPD Peptide - middle region
PEPD Peptide - middle region
Product Specifications
Product Name Alternative
PROLIDASE
UniProt
P12955
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PEPD Rabbit Polyclonal Antibody (orb588332) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_000276.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PA1879-Dylight550 100 µg
Anti-DDR2 Antibody Picoband®, Dylight550 Conjugate
Sign In for Pricing
View Details 
MBS1075002-01 0.02 mg (E-Coli)
Recombinant Mouse Regulator of G-protein signaling 4 (Rgs4)
Sign In for Pricing
View Details MBS1075002-02 0.1 mg (E-Coli)
Recombinant Mouse Regulator of G-protein signaling 4 (Rgs4)
Sign In for Pricing
View Details MBS1075002-03 0.02 mg (Yeast)
Recombinant Mouse Regulator of G-protein signaling 4 (Rgs4)
Sign In for Pricing
View Details MBS1075002-04 0.1 mg (Yeast)
Recombinant Mouse Regulator of G-protein signaling 4 (Rgs4)
Sign In for Pricing
View Details MBS1075002-05 0.02 mg (Baculovirus)
Recombinant Mouse Regulator of G-protein signaling 4 (Rgs4)
Sign In for Pricing
View Details