PHB Peptide - middle region
PHB Peptide - middle region
Product Specifications
Product Name Alternative
PHB1, HEL-215, HEL-S-54e
UniProt
P35232
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PHB Rabbit Polyclonal Antibody (orb588334) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001268425.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
777350 5.000 pieces per CAR
Sapphire pipette tip, 1000 μl, polypropylene, 1000 pcs/bag, 5.000 pieces per CAR
Sign In for Pricing
View Details 