PPP3CC Peptide - middle region
PPP3CC Peptide - middle region
Product Specifications
Product Name Alternative
CNA3, CALNA3, PP2Bgamma
UniProt
P48454
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPP3CC Rabbit Polyclonal Antibody (orb588664) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001230903.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GMSPEITSLDDIRKLDRFTEPPAFGPVCDLLWSDPSEDYGNEKTLEHYTH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GR215001 37 Samples
Nori® Bovine IL-1b ELISA Test Service (up to 37 samples)
Sign In for Pricing
View Details GTR15113180 1 Vial
Lentiviral mouse Mast4 shRNA (UAS) - Lentiviral mouseMast4 shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details