PTPRE Peptide - middle region
PTPRE Peptide - middle region
Product Specifications
Product Name Alternative
PTPE, HPTPE, R-PTP-EPSILON
UniProt
P23469
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PTPRE Rabbit Polyclonal Antibody (orb588671) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006495.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QFREEFNSLPSGHIQGTFELANKEENREKNRYPNILPNDHSRVILSQLDG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1124888-01 0.02 mg (E-Coli)
Recombinant Salmonella typhimurium Biotin synthase (bioB)
Sign In for Pricing
View Details MBS1124888-02 0.02 mg (Yeast)
Recombinant Salmonella typhimurium Biotin synthase (bioB)
Sign In for Pricing
View Details MBS1124888-03 0.1 mg (E-Coli)
Recombinant Salmonella typhimurium Biotin synthase (bioB)
Sign In for Pricing
View Details MBS1124888-04 0.1 mg (Yeast)
Recombinant Salmonella typhimurium Biotin synthase (bioB)
Sign In for Pricing
View Details MBS1124888-05 0.02 mg (Baculovirus)
Recombinant Salmonella typhimurium Biotin synthase (bioB)
Sign In for Pricing
View Details MBS1124888-06 0.02 mg (Mammalian-Cell)
Recombinant Salmonella typhimurium Biotin synthase (bioB)
Sign In for Pricing
View Details