Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPRE Peptide - middle region

PTPRE Peptide - middle region

Product Specifications

Product Name Alternative

PTPE, HPTPE, R-PTP-EPSILON

UniProt

P23469

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTPRE Rabbit Polyclonal Antibody (orb588671) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006495.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QFREEFNSLPSGHIQGTFELANKEENREKNRYPNILPNDHSRVILSQLDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human NSUN6 polyclonal antibody
CABT-B342-01 100 ul

Rabbit Anti-Human NSUN6 polyclonal antibody

Sign In for Pricing
View Details
Rabbit Anti-Human NSUN6 polyclonal antibody
CABT-B342-02 1 mg

Rabbit Anti-Human NSUN6 polyclonal antibody

Sign In for Pricing
View Details
NALP6 Polyclonal Antibody, HRP Conjugated
bs-10440R-HRP 100 µL

NALP6 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
CST2 Antibody Blocking Peptide
orb1512599 500 µg

CST2 Antibody Blocking Peptide

Sign In for Pricing
View Details
Heat Shock 110 kDa Protein (HSP110) Antibody (PerCP)
abx446906 100 µg

Heat Shock 110 kDa Protein (HSP110) Antibody (PerCP)

Sign In for Pricing
View Details
FBXL13 Antibody
MBS9523154-01 0.04 mL

FBXL13 Antibody

Sign In for Pricing
View Details