Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBCE Peptide - N-terminal region

TBCE Peptide - N-terminal region

Product Specifications

Product Name Alternative

HRD, KCS, KCS1, pac2

UniProt

Q15813

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBCE Rabbit Polyclonal Antibody (orb588685) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001072983.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VAGPWLGVEWDNPERGKHDGSHEGTVYFKCRHPTGGSFIRPNKVNFGTDF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Rectum
CS804864 5x 5 µm

Tissue FFPE Sections, Rectum

Sign In for Pricing
View Details
HSV1 (Herpes Simplex Virus Type I) (HSVI/2095), CF647 conjugate, 0.1mg/mL
BNC472095-500 1x 500 µL

HSV1 (Herpes Simplex Virus Type I) (HSVI/2095), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Btnl4 Mouse Gene Knockout Kit (CRISPR)
KN502317 1 Kit

Btnl4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TBX20 activation kit by CRISPRa
GA111354 1 Kit

Human TBX20 activation kit by CRISPRa

Sign In for Pricing
View Details
GFAP (NM_002055) Human Over-expression Lysate
LC419563 20 µg

GFAP (NM_002055) Human Over-expression Lysate

Sign In for Pricing
View Details
C5orf52 (NM_001145132) Human Over-expression Lysate
LC428712 20 µg

C5orf52 (NM_001145132) Human Over-expression Lysate

Sign In for Pricing
View Details