Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBCE Peptide - N-terminal region

TBCE Peptide - N-terminal region

Product Specifications

Product Name Alternative

HRD, KCS, KCS1, pac2

UniProt

Q15813

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBCE Rabbit Polyclonal Antibody (orb588685) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001072983.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VAGPWLGVEWDNPERGKHDGSHEGTVYFKCRHPTGGSFIRPNKVNFGTDF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S)-3-Amino-3-phenylpropan-1-ol
TRC-A634770-10MG 10 mg

(S)-3-Amino-3-phenylpropan-1-ol

Sign In for Pricing
View Details
Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G1]
TA504054BM 100 µL

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G1]

Sign In for Pricing
View Details
Pyruvate Kinase Microplate Assay Kit
RDSM074 100 Assays

Pyruvate Kinase Microplate Assay Kit

Sign In for Pricing
View Details
FITC Anti-Mouse CD4 Antibody[GK1.5]
E-AB-F1097C-01 50 Tests

FITC Anti-Mouse CD4 Antibody[GK1.5]

Sign In for Pricing
View Details
FITC Anti-Mouse CD4 Antibody[GK1.5]
E-AB-F1097C-02 100 Tests

FITC Anti-Mouse CD4 Antibody[GK1.5]

Sign In for Pricing
View Details
FITC Anti-Mouse CD4 Antibody[GK1.5]
E-AB-F1097C-03 2x 100 Tests

FITC Anti-Mouse CD4 Antibody[GK1.5]

Sign In for Pricing
View Details