TCN2 Peptide - middle region
TCN2 Peptide - middle region
Product Specifications
Product Name Alternative
II, TC, TC2, TC-2, TCII, TC II, D22S676, D22S750
UniProt
P20062
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TCN2 Rabbit Polyclonal Antibody (orb588687) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_000346.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GHKGDRLVSQLKWFLEDEKRAIGHDHKGHPHTSYYQYGLGILALCLHQKR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSH030492 50 µg
Recombinant Human Frizzled-4/FZD4 Protein (His Tag)
Sign In for Pricing
View Details 
BNC042659-100 1x 100 µL
Cytokeratin 13 (Non-Keratinized Squamous Epithelial Marker) (KRT13/2213), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942713-100 1x 100 µL
Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2713), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-UNEL-H0222-01 5x 96 Tests
Uncoated Human VE-Cadherin (Vascular Endothelial Cadherin) ELISA Kit
Sign In for Pricing
View Details E-UNEL-H0222-02 15x 96 Tests
Uncoated Human VE-Cadherin (Vascular Endothelial Cadherin) ELISA Kit
Sign In for Pricing
View Details