Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCN2 Peptide - middle region

TCN2 Peptide - middle region

Product Specifications

Product Name Alternative

II, TC, TC2, TC-2, TCII, TC II, D22S676, D22S750

UniProt

P20062

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TCN2 Rabbit Polyclonal Antibody (orb588687) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000346.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GHKGDRLVSQLKWFLEDEKRAIGHDHKGHPHTSYYQYGLGILALCLHQKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSH1 Polyclonal Antibody
E-AB-11300-01 20 µL

CSH1 Polyclonal Antibody

Sign In for Pricing
View Details
CSH1 Polyclonal Antibody
E-AB-11300-02 60 µL

CSH1 Polyclonal Antibody

Sign In for Pricing
View Details
CSH1 Polyclonal Antibody
E-AB-11300-03 120 µL

CSH1 Polyclonal Antibody

Sign In for Pricing
View Details
CSH1 Polyclonal Antibody
E-AB-11300-04 200 µL

CSH1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Dectin-1/CLEC7A Protein (Fc Tag)
PKSH033706-01 10 µg

Recombinant Human Dectin-1/CLEC7A Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human Dectin-1/CLEC7A Protein (Fc Tag)
PKSH033706-02 50 µg

Recombinant Human Dectin-1/CLEC7A Protein (Fc Tag)

Sign In for Pricing
View Details