Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFAP2C Peptide - N-terminal region

TFAP2C Peptide - N-terminal region

Product Specifications

Product Name Alternative

ERF1, TFAP2G, hAP-2g, AP2-GAMMA

UniProt

Q92754

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TFAP2C Rabbit Polyclonal Antibody (orb588690) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003213.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHTGVAEYQPPPYFPPPYQQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLCO2B1 Human Gene Knockout Kit (CRISPR)
KN207759RB 1 Kit

SLCO2B1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FADD Recombinant Rabbit monoclonal Antibody
HA751190 100 µL

FADD Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CA12 Antibody (Biotin)
KB-22760-01 50 μL

CA12 Antibody (Biotin)

Sign In for Pricing
View Details
CA12 Antibody (Biotin)
KB-22760-02 100 µL

CA12 Antibody (Biotin)

Sign In for Pricing
View Details
CA12 Antibody (Biotin)
KB-22760-03 1 mL

CA12 Antibody (Biotin)

Sign In for Pricing
View Details
Nociceptin Trifluoroacetic Acid Salt
TRC-N634100-25MG 25 mg

Nociceptin Trifluoroacetic Acid Salt

Sign In for Pricing
View Details