Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFAP2C Peptide - N-terminal region

TFAP2C Peptide - N-terminal region

Product Specifications

Product Name Alternative

ERF1, TFAP2G, hAP-2g, AP2-GAMMA

UniProt

Q92754

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TFAP2C Rabbit Polyclonal Antibody (orb588690) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003213.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHTGVAEYQPPPYFPPPYQQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BEND3 (NM_001080450) Human Over-expression Lysate
LC420708 20 µg

BEND3 (NM_001080450) Human Over-expression Lysate

Sign In for Pricing
View Details
MUSK Rabbit Polyclonal Antibody
AP14388PU-N 400 µL

MUSK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD48 Antibody[HM48-1]
E-AB-F1017H-01 50 Tests

PE/Cyanine7 Anti-Mouse CD48 Antibody[HM48-1]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD48 Antibody[HM48-1]
E-AB-F1017H-02 100 Tests

PE/Cyanine7 Anti-Mouse CD48 Antibody[HM48-1]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD48 Antibody[HM48-1]
E-AB-F1017H-03 2x 100 Tests

PE/Cyanine7 Anti-Mouse CD48 Antibody[HM48-1]

Sign In for Pricing
View Details
CTBP2 Mouse Monoclonal Antibody [Clone ID: OTI4D4]
CF807909 100 µg

CTBP2 Mouse Monoclonal Antibody [Clone ID: OTI4D4]

Sign In for Pricing
View Details