Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UGT2B17 Peptide - middle region

UGT2B17 Peptide - middle region

Product Specifications

Product Name Alternative

BMND12, UDPGT2B17

UniProt

O75795

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UGT2B17 Rabbit Polyclonal Antibody (orb55759) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001068.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLP

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rap2c (BC064814) Mouse Untagged Clone
MC207124 10 µg

Rap2c (BC064814) Mouse Untagged Clone

Sign In for Pricing
View Details
pCR4-TOPO-AGAP11 Plasmid
PVT31162 2 µg

pCR4-TOPO-AGAP11 Plasmid

Sign In for Pricing
View Details
Recombinant Bothrops marajoensis Phospholipase A2, basic 2
MBS1041059-01 0.02 mg (E-Coli)

Recombinant Bothrops marajoensis Phospholipase A2, basic 2

Sign In for Pricing
View Details
Recombinant Bothrops marajoensis Phospholipase A2, basic 2
MBS1041059-02 0.1 mg (E-Coli)

Recombinant Bothrops marajoensis Phospholipase A2, basic 2

Sign In for Pricing
View Details
Recombinant Bothrops marajoensis Phospholipase A2, basic 2
MBS1041059-03 0.02 mg (Yeast)

Recombinant Bothrops marajoensis Phospholipase A2, basic 2

Sign In for Pricing
View Details
Recombinant Bothrops marajoensis Phospholipase A2, basic 2
MBS1041059-04 0.1 mg (Yeast)

Recombinant Bothrops marajoensis Phospholipase A2, basic 2

Sign In for Pricing
View Details