ZNF37A Peptide - middle region
ZNF37A Peptide - middle region
Product Specifications
Product Name Alternative
KOX21, ZNF37
UniProt
P17032
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF37A Rabbit Polyclonal Antibody (orb588698) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001007095.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NTSRNYSIMKFNEFNKGGKCFCDEKHEIIHSEEEPSEYNKNGNSFWLNED
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx152494-01 96 Tests
Human Neurofilament Medium Polypeptide / NEF3 (NEFM) ELISA Kit
Sign In for Pricing
View Details abx152494-02 5x 96 Tests
Human Neurofilament Medium Polypeptide / NEF3 (NEFM) ELISA Kit
Sign In for Pricing
View Details abx152494-03 10x 96 Tests
Human Neurofilament Medium Polypeptide / NEF3 (NEFM) ELISA Kit
Sign In for Pricing
View Details VAng-Lsx0650-50gEcoli 50 µg (E. coli)
Recombinant Aeromonas Hydrophila ahyI Protein
Sign In for Pricing
View Details 
GTR10439223 96 Well
Human ADP ribosylation factor binding protein GGA1 (GGA1) ELISA kit
Sign In for Pricing
View Details