ZNF37A Peptide - middle region
ZNF37A Peptide - middle region
Product Specifications
Product Name Alternative
KOX21, ZNF37
UniProt
P17032
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF37A Rabbit Polyclonal Antibody (orb588698) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001007095.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NTSRNYSIMKFNEFNKGGKCFCDEKHEIIHSEEEPSEYNKNGNSFWLNED
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx620528-01 100 µg
Human Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 6 (LILRA6) Protein
Sign In for Pricing
View Details abx620528-02 1 mg
Human Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 6 (LILRA6) Protein
Sign In for Pricing
View Details 
orb2666466-01 1 mg
HSV-1 gB Human Monoclonal Antibody (MALS verified)
Sign In for Pricing
View Details orb2666466-02 100 µg
HSV-1 gB Human Monoclonal Antibody (MALS verified)
Sign In for Pricing
View Details ![Mouse Monoclonal BHMT Antibody (OTI3E11) [Allophycocyanin]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
NBP2-70250APC 0.1 mL
Mouse Monoclonal BHMT Antibody (OTI3E11) [Allophycocyanin]
Sign In for Pricing
View Details