Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF103 Peptide - middle region

RNF103 Peptide - middle region

Product Specifications

Product Name Alternative

KF1, KF-1, HKF-1, ZFP103, ZFP-103

UniProt

O00237

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RNF103 Rabbit Polyclonal Antibody (orb588700) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001185880.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HPALFLSTYLGHGLLIDYFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSY

More Discoveries

Explore Other Products

Browse additional items from our catalog

DTX4 Recombinant Protein Antigen
NBP2-32448PEP 0.1 mL

DTX4 Recombinant Protein Antigen

Sign In for Pricing
View Details
ATG5 Polyclonal Antibody
RD77716A-01 20 µL

ATG5 Polyclonal Antibody

Sign In for Pricing
View Details
ATG5 Polyclonal Antibody
RD77716A-02 60 μL

ATG5 Polyclonal Antibody

Sign In for Pricing
View Details
ATG5 Polyclonal Antibody
RD77716A-03 120 μL

ATG5 Polyclonal Antibody

Sign In for Pricing
View Details
ATG5 Polyclonal Antibody
RD77716A-04 200 µL

ATG5 Polyclonal Antibody

Sign In for Pricing
View Details
IHH Antibody, HRP conjugated
A55691-50UG 50 µg

IHH Antibody, HRP conjugated

Sign In for Pricing
View Details