Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF103 Peptide - middle region

RNF103 Peptide - middle region

Product Specifications

Product Name Alternative

KF1, KF-1, HKF-1, ZFP103, ZFP-103

UniProt

O00237

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RNF103 Rabbit Polyclonal Antibody (orb588700) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001185880.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HPALFLSTYLGHGLLIDYFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSY

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Semaphorin 6B Antibody (2H7)
H00010501-M01 0.1 mg

Mouse Monoclonal Semaphorin 6B Antibody (2H7)

Sign In for Pricing
View Details
Rabbit Polyclonal IL-27 Antibody [DyLight 680]
NBP1-76698FR 0.1 mL

Rabbit Polyclonal IL-27 Antibody [DyLight 680]

Sign In for Pricing
View Details
Anti-IRS1 (pS307) Phospho Antibody
MBS8243162-01 0.03 mL

Anti-IRS1 (pS307) Phospho Antibody

Sign In for Pricing
View Details
Anti-IRS1 (pS307) Phospho Antibody
MBS8243162-02 0.05 mL

Anti-IRS1 (pS307) Phospho Antibody

Sign In for Pricing
View Details
Anti-IRS1 (pS307) Phospho Antibody
MBS8243162-03 0.1 mL

Anti-IRS1 (pS307) Phospho Antibody

Sign In for Pricing
View Details
Anti-IRS1 (pS307) Phospho Antibody
MBS8243162-04 0.2 mL

Anti-IRS1 (pS307) Phospho Antibody

Sign In for Pricing
View Details