Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAVIN2 Peptide - N-terminal region

CAVIN2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SDR, SDPR, PS-p68, cavin-2

UniProt

O95810

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAVIN2 Rabbit Polyclonal Antibody (orb588709) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004648.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QHPGSDMRQEKPSSPSPMPSSTPSPSLNLGNTEEAIRDNSQVNAVTVLTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC9B Antibody Blocking peptide
orb1459094 500 µg

TTC9B Antibody Blocking peptide

Sign In for Pricing
View Details
Eif2b3 (NM_001111277) Mouse Untagged Clone
MC216029 10 µg

Eif2b3 (NM_001111277) Mouse Untagged Clone

Sign In for Pricing
View Details
Lrrc57 (NM_025657) Mouse Recombinant Protein
PM47987M5 20 µg

Lrrc57 (NM_025657) Mouse Recombinant Protein

Sign In for Pricing
View Details
MacroH2A.1 polyclonal antibody
orb1718587-01 50 µL

MacroH2A.1 polyclonal antibody

Sign In for Pricing
View Details
MacroH2A.1 polyclonal antibody
orb1718587-02 100 µL

MacroH2A.1 polyclonal antibody

Sign In for Pricing
View Details
R3HDM4 Protein Vector (Human) (pPM-C-His)
PV114481 500 ng

R3HDM4 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details