Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAVIN2 Peptide - N-terminal region

CAVIN2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SDR, SDPR, PS-p68, cavin-2

UniProt

O95810

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAVIN2 Rabbit Polyclonal Antibody (orb588709) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004648.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QHPGSDMRQEKPSSPSPMPSSTPSPSLNLGNTEEAIRDNSQVNAVTVLTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD19 Antibody (CB19) [FITC]
NBP2-25196F 0.1 mL

Mouse Monoclonal CD19 Antibody (CB19) [FITC]

Sign In for Pricing
View Details
CFTR Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV659910 1.0 µg DNA

CFTR Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
MCCD1P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV732596 1.0 µg DNA

MCCD1P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
N- (2-Methylphenyl) -5,6-dihydro-4H-1,3-thiazin-2-amine
CBA77914-01 0.5 g

N- (2-Methylphenyl) -5,6-dihydro-4H-1,3-thiazin-2-amine

Sign In for Pricing
View Details
N- (2-Methylphenyl) -5,6-dihydro-4H-1,3-thiazin-2-amine
CBA77914-02 5 g

N- (2-Methylphenyl) -5,6-dihydro-4H-1,3-thiazin-2-amine

Sign In for Pricing
View Details
CDH5 Antibody (Phospho-Tyr731)
OASG07518-100UL 100 µL

CDH5 Antibody (Phospho-Tyr731)

Sign In for Pricing
View Details