Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDLIM7 Peptide - middle region

PDLIM7 Peptide - middle region

Product Specifications

Product Name Alternative

LMP1, LMP3

UniProt

Q9NR12

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDLIM7 Rabbit Polyclonal Antibody (orb588726) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005442.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KKSSQVPRTEAPAPASSTPQEPWPGPTAPSPTSRPPWAVDPAFAERYAPD

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100B Polyclonal Antibody
E-AB-60087-01 60 µL

S100B Polyclonal Antibody

Sign In for Pricing
View Details
S100B Polyclonal Antibody
E-AB-60087-02 120 µL

S100B Polyclonal Antibody

Sign In for Pricing
View Details
S100B Polyclonal Antibody
E-AB-60087-03 200 µL

S100B Polyclonal Antibody

Sign In for Pricing
View Details
IBSP polyclonal antibody
orb1720170-01 50 µL

IBSP polyclonal antibody

Sign In for Pricing
View Details
IBSP polyclonal antibody
orb1720170-02 100 µL

IBSP polyclonal antibody

Sign In for Pricing
View Details
Recombinant Treponema Pallidum rplS Protein (aa 1-123) (strain SS14)
VAng-Cr1253-500gEcoli 500 µg (E. coli)

Recombinant Treponema Pallidum rplS Protein (aa 1-123) (strain SS14)

Sign In for Pricing
View Details