Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLEKHM1 Peptide - middle region

PLEKHM1 Peptide - middle region

Product Specifications

Product Name Alternative

B2, AP162, OPTB6

UniProt

Q69YJ1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLEKHM1 Rabbit Polyclonal Antibody (orb588742) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055613.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AEDWLDRVREALQKVRPQQEDEWVNVQYPDQPEEPPEAPQGCLSPSDLLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RBMS3 Antibody Picoband® (Dylight488 Conjugate)
A12416-3-Dylight488 100 µg

Anti-RBMS3 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
FDFT Antibody
MBS9520066-01 0.04 mL

FDFT Antibody

Sign In for Pricing
View Details
FDFT Antibody
MBS9520066-02 0.1 mL

FDFT Antibody

Sign In for Pricing
View Details
FDFT Antibody
MBS9520066-03 0.2 mL

FDFT Antibody

Sign In for Pricing
View Details
FDFT Antibody
MBS9520066-04 5x 0.2 mL

FDFT Antibody

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Glutamate--cysteine ligase (gshA), partial
MBS1452162 Inquire

Recombinant Salmonella paratyphi A Glutamate--cysteine ligase (gshA), partial

Sign In for Pricing
View Details