Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HS3ST2 Peptide - middle region

HS3ST2 Peptide - middle region

Product Specifications

Product Name Alternative

30ST2, 3OST2

UniProt

Q9Y278

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HS3ST2 Rabbit Polyclonal Antibody (orb588746) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006034.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SAPAAAVPAPRLSGSNHSGSPKLGTKRLPQALIVGVKKGGTRAVLEFIRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mus caroli Beta-2-microglobulin (B2m)
MBS1050595-01 0.02 mg (E-Coli)

Recombinant Mus caroli Beta-2-microglobulin (B2m)

Sign In for Pricing
View Details
Recombinant Mus caroli Beta-2-microglobulin (B2m)
MBS1050595-02 0.1 mg (E-Coli)

Recombinant Mus caroli Beta-2-microglobulin (B2m)

Sign In for Pricing
View Details
Recombinant Mus caroli Beta-2-microglobulin (B2m)
MBS1050595-03 0.02 mg (Yeast)

Recombinant Mus caroli Beta-2-microglobulin (B2m)

Sign In for Pricing
View Details
Recombinant Mus caroli Beta-2-microglobulin (B2m)
MBS1050595-04 0.1 mg (Yeast)

Recombinant Mus caroli Beta-2-microglobulin (B2m)

Sign In for Pricing
View Details
Recombinant Mus caroli Beta-2-microglobulin (B2m)
MBS1050595-05 0.02 mg (Baculovirus)

Recombinant Mus caroli Beta-2-microglobulin (B2m)

Sign In for Pricing
View Details
Recombinant Mus caroli Beta-2-microglobulin (B2m)
MBS1050595-06 1 mg (E-Coli)

Recombinant Mus caroli Beta-2-microglobulin (B2m)

Sign In for Pricing
View Details