Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HS3ST2 Peptide - middle region

HS3ST2 Peptide - middle region

Product Specifications

Product Name Alternative

30ST2, 3OST2

UniProt

Q9Y278

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HS3ST2 Rabbit Polyclonal Antibody (orb588746) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006034.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SAPAAAVPAPRLSGSNHSGSPKLGTKRLPQALIVGVKKGGTRAVLEFIRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LINC00085 ORF Vector (Human) (pORF)
ORF022736 1.0 µg DNA

LINC00085 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Hamster Stereocilin (STRC) ELISA Kit
MBS9937882-01 48 Well

Hamster Stereocilin (STRC) ELISA Kit

Sign In for Pricing
View Details
Hamster Stereocilin (STRC) ELISA Kit
MBS9937882-02 96 Well

Hamster Stereocilin (STRC) ELISA Kit

Sign In for Pricing
View Details
Hamster Stereocilin (STRC) ELISA Kit
MBS9937882-03 5x 96 Well

Hamster Stereocilin (STRC) ELISA Kit

Sign In for Pricing
View Details
Hamster Stereocilin (STRC) ELISA Kit
MBS9937882-04 10x 96 Well

Hamster Stereocilin (STRC) ELISA Kit

Sign In for Pricing
View Details
Primidone-d5
CS-O-02718 1 Each

Primidone-d5

Sign In for Pricing
View Details