Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTLL5 Peptide - middle region

TTLL5 Peptide - middle region

Product Specifications

Product Name Alternative

STAMP, CORD19, KIAA0998

UniProt

Q6EMB2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTLL5 Rabbit Polyclonal Antibody (orb588793) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055887.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RQASEAELEEVLTFYTQKNKSASVFLGTHSKISKNNNNYSDSGAKGDHPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppil1 Mouse siRNA Oligo Duplex (Locus ID 68816)
SR403782 1 Kit

Ppil1 Mouse siRNA Oligo Duplex (Locus ID 68816)

Sign In for Pricing
View Details
ALX4, ID (ALX4, KIAA1788, Homeobox protein aristaless-like 4) (FITC)
MBS6273117-01 0.2 mL

ALX4, ID (ALX4, KIAA1788, Homeobox protein aristaless-like 4) (FITC)

Sign In for Pricing
View Details
ALX4, ID (ALX4, KIAA1788, Homeobox protein aristaless-like 4) (FITC)
MBS6273117-02 5x 0.2 mL

ALX4, ID (ALX4, KIAA1788, Homeobox protein aristaless-like 4) (FITC)

Sign In for Pricing
View Details
Micrewtube conical 2.0mL Strl Prntd
TUB2228 500 / PCK

Micrewtube conical 2.0mL Strl Prntd

Sign In for Pricing
View Details
Olr1684 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV633584 1.0 µg DNA

Olr1684 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
OR8H2 ORF Vector (Human) (pORF)
ORF027227 1.0 µg DNA

OR8H2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details