Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTLL5 Peptide - middle region

TTLL5 Peptide - middle region

Product Specifications

Product Name Alternative

STAMP, CORD19, KIAA0998

UniProt

Q6EMB2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTLL5 Rabbit Polyclonal Antibody (orb588793) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055887.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RQASEAELEEVLTFYTQKNKSASVFLGTHSKISKNNNNYSDSGAKGDHPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ptprn sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
38180116 3x 1.0 µg

Ptprn sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Fish Protein Kinase B ELISA Kit
MBS017886 Inquire

Fish Protein Kinase B ELISA Kit

Sign In for Pricing
View Details
SET (NM_001122821) Human Tagged ORF Clone
RC225400 10 µg

SET (NM_001122821) Human Tagged ORF Clone

Sign In for Pricing
View Details
IgG2b Isotype Control Fc fusion protein
35R-0025 100 ug

IgG2b Isotype Control Fc fusion protein

Sign In for Pricing
View Details
SAMD15 AAV Vector (Human) (CMV)
42995101 1 µg

SAMD15 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
SLPI ORF Vector (Human) (pORF)
44379011 1.0 µg DNA

SLPI ORF Vector (Human) (pORF)

Sign In for Pricing
View Details