EHD2 Peptide - middle region
EHD2 Peptide - middle region
Product Specifications
Product Name Alternative
PAST2
UniProt
Q9NZN4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EHD2 Rabbit Polyclonal Antibody (orb588825) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055416.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HMGPFVERGPDEAMEDGEEGSDDEAEWVVTKDKSKYDEIFYNLAPADGKL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1427819-01 0.02 mg (E-Coli)
Recombinant Arabidopsis thaliana Putative two-component response regulator-like APRR4 (APRR4)
Sign In for Pricing
View Details MBS1427819-02 0.02 mg (Yeast)
Recombinant Arabidopsis thaliana Putative two-component response regulator-like APRR4 (APRR4)
Sign In for Pricing
View Details MBS1427819-03 0.1 mg (E-Coli)
Recombinant Arabidopsis thaliana Putative two-component response regulator-like APRR4 (APRR4)
Sign In for Pricing
View Details MBS1427819-04 0.1 mg (Yeast)
Recombinant Arabidopsis thaliana Putative two-component response regulator-like APRR4 (APRR4)
Sign In for Pricing
View Details