Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCHCR1 Peptide - N-terminal region

CCHCR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HCR, SBP, C6orf18

UniProt

Q8TD31

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCHCR1 Rabbit Polyclonal Antibody (orb588837) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099033.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSDIPLVQPPGHQDVSERRLDTQRPQVTMWERDVSSDRQEPGRRGRSWGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Tryptophan-15N2
TRC-T204634-25MG 25 mg

L-Tryptophan-15N2

Sign In for Pricing
View Details
NEIL3 Antibody
8C15635-AAT 50 µg

NEIL3 Antibody

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/3171R), CF647 conjugate, 0.1mg/mL
BNC473171-100 1x 100 µL

CD3e (T-Cell Marker) (C3e/3171R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C9orf25 (FAM219A) Human Gene Knockout Kit (CRISPR)
KN415183 1 Kit

C9orf25 (FAM219A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tropic acid
TRC-T892620-25G 25 g

Tropic acid

Sign In for Pricing
View Details
DEX Rabbit Polyclonal Antibody
TA396911 100 µg

DEX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details