CCHCR1 Peptide - N-terminal region
CCHCR1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
HCR, SBP, C6orf18
UniProt
Q8TD31
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CCHCR1 Rabbit Polyclonal Antibody (orb588837) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001099033.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LSDIPLVQPPGHQDVSERRLDTQRPQVTMWERDVSSDRQEPGRRGRSWGL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
KN425536 1 Kit
C14orf148 (NOXRED1) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
