Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG10 Peptide - C-terminal region

VSIG10 Peptide - C-terminal region

Product Specifications

UniProt

Q8N0Z9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VSIG10 Rabbit Polyclonal Antibody (orb588839) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061959.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKEIPKQDHIHRVTALVNGNIEQMGNGFQDLQDDSSEEQSDIVQEEDRPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH3RF1 (HRP)
576243-01 50 µg

SH3RF1 (HRP)

Sign In for Pricing
View Details
SH3RF1 (HRP)
576243-02 100 µg

SH3RF1 (HRP)

Sign In for Pricing
View Details
Dbndd2 3'UTR GFP Stable Cell Line
TU253167 1.0 mL

Dbndd2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
KCNE4 Rabbit Polyclonal Antibody (BF680)
orb2537079 100 µL

KCNE4 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
RANTES (Regulated on Activation, Normal T-cell Expressed and Secreted, CCL5) (MaxLight 550)
MBS6496883-01 0.1 mL

RANTES (Regulated on Activation, Normal T-cell Expressed and Secreted, CCL5) (MaxLight 550)

Sign In for Pricing
View Details
RANTES (Regulated on Activation, Normal T-cell Expressed and Secreted, CCL5) (MaxLight 550)
MBS6496883-02 5x 0.1 mL

RANTES (Regulated on Activation, Normal T-cell Expressed and Secreted, CCL5) (MaxLight 550)

Sign In for Pricing
View Details