Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1B10 Peptide - middle region

AKR1B10 Peptide - middle region

Product Specifications

Product Name Alternative

HIS, HSI, ARL1, ARL-1, ALDRLn, AKR1B11, AKR1B12

UniProt

O60218

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AKR1B10 Rabbit Polyclonal Antibody (orb588857) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064695.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWEAMEELV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Protein NDRG1 NDRG1 Antibody Picoband®, Carrier-free
PA1416-carrier-free 100 µg/Vial

Anti-Protein NDRG1 NDRG1 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
DNASE1L1 Knockout SK-HEP-1 Polyclonal Cells
ARG39374 1 Million

DNASE1L1 Knockout SK-HEP-1 Polyclonal Cells

Sign In for Pricing
View Details
Polyclonal Antibody to Fatty Acid Binding Protein 6, Ileal (FABP6)
TRV-0047549-01 20 µL

Polyclonal Antibody to Fatty Acid Binding Protein 6, Ileal (FABP6)

Sign In for Pricing
View Details
Polyclonal Antibody to Fatty Acid Binding Protein 6, Ileal (FABP6)
TRV-0047549-02 100 µL

Polyclonal Antibody to Fatty Acid Binding Protein 6, Ileal (FABP6)

Sign In for Pricing
View Details
Polyclonal Antibody to Fatty Acid Binding Protein 6, Ileal (FABP6)
TRV-0047549-03 200 µL

Polyclonal Antibody to Fatty Acid Binding Protein 6, Ileal (FABP6)

Sign In for Pricing
View Details
Polyclonal Antibody to Fatty Acid Binding Protein 6, Ileal (FABP6)
TRV-0047549-04 1 mL

Polyclonal Antibody to Fatty Acid Binding Protein 6, Ileal (FABP6)

Sign In for Pricing
View Details