Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1B10 Peptide - middle region

AKR1B10 Peptide - middle region

Product Specifications

Product Name Alternative

HIS, HSI, ARL1, ARL-1, ALDRLn, AKR1B11, AKR1B12

UniProt

O60218

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AKR1B10 Rabbit Polyclonal Antibody (orb588857) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064695.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWEAMEELV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human cytokeratin 13 (CK-13) ELISA Kit
YP-W17739-01 48 Tests

Human cytokeratin 13 (CK-13) ELISA Kit

Sign In for Pricing
View Details
Human cytokeratin 13 (CK-13) ELISA Kit
YP-W17739-02 96 Tests

Human cytokeratin 13 (CK-13) ELISA Kit

Sign In for Pricing
View Details
ZNF85 (Zinc Finger Protein 85, HPF4, HTF1, MGC78566) (MaxLight 550)
253884-ML550 100 µL

ZNF85 (Zinc Finger Protein 85, HPF4, HTF1, MGC78566) (MaxLight 550)

Sign In for Pricing
View Details
Lentiviral mouse Dusp13 shRNA (UAS) - Lentiviral mouse Dusp13 shRNA (UAS) (25)
GTR15250013 1 Vial

Lentiviral mouse Dusp13 shRNA (UAS) - Lentiviral mouse Dusp13 shRNA (UAS) (25)

Sign In for Pricing
View Details
Human Heme-Oncology Peripheral Blood Mononuclear Cells
ABC-TC4327 1 Vial

Human Heme-Oncology Peripheral Blood Mononuclear Cells

Sign In for Pricing
View Details
InVivoMAb Anti-Orthohantavirus puumalaense GP/Envelopment polyprotein Antibody (4G2)
ARO-A19041 100 µg

InVivoMAb Anti-Orthohantavirus puumalaense GP/Envelopment polyprotein Antibody (4G2)

Sign In for Pricing
View Details