Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF286A Peptide - middle region

ZNF286A Peptide - middle region

Product Specifications

Product Name Alternative

ZNF286

UniProt

Q9HBT8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF286A Rabbit Polyclonal Antibody (orb588863) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001124314.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ENYRNLVSLWLPVSKPESYNLENGKEPLKLERKAPKSSYSDMETRPQSKD

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (3,4-Difluorophenyl) -piperazine
sc-320024A 5 g

1- (3,4-Difluorophenyl) -piperazine

Sign In for Pricing
View Details
Nadecnemab (Anti-GFRA3)
C00280-1mg 1 mg

Nadecnemab (Anti-GFRA3)

Sign In for Pricing
View Details
Mouse Monoclonal COMMD1 Antibody (OTI2E2) [PE/Cy7]
NBP2-72418PECY7 0.1 mL

Mouse Monoclonal COMMD1 Antibody (OTI2E2) [PE/Cy7]

Sign In for Pricing
View Details
Tube holder, 5 x 5-7ml, 2/pk (1 pack included)
R2020-0507 1 Each

Tube holder, 5 x 5-7ml, 2/pk (1 pack included)

Sign In for Pricing
View Details
IDH1 Antibody, Biotin conjugated
MBS7052068-01 0.05 mg

IDH1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
IDH1 Antibody, Biotin conjugated
MBS7052068-02 0.1 mg

IDH1 Antibody, Biotin conjugated

Sign In for Pricing
View Details