ZNF286A Peptide - middle region
ZNF286A Peptide - middle region
Product Specifications
Product Name Alternative
ZNF286
UniProt
Q9HBT8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF286A Rabbit Polyclonal Antibody (orb588863) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001124314.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ENYRNLVSLWLPVSKPESYNLENGKEPLKLERKAPKSSYSDMETRPQSKD
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV757042 1.0 µg DNA
ACTBP1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
Sign In for Pricing
View Details 
bsm-52156R-RBITC 100 µL
FOXO3a (Ser253) Monoclonal Antibody, RBITC Conjugated
Sign In for Pricing
View Details 
DLR-EG-VEGF-b-48T 48 Tests
Bovine Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit
Sign In for Pricing
View Details